PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G263600.1.p
Common NameGLYMA_07G263600, LOC100127401
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 363aa    MW: 40816.2 Da    PI: 6.6535
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G263600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-092883241955
                          HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                           +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Glyma.07G263600.1.p 288 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 324
                          45679*****************************885 PP

2ELK38.23e-13244264121
                  ELK   1 ELKhqLlrKYsgyLgsLkqEF 21 
                          ELK qLlrKY+gyLgsLkqEF
  Glyma.07G263600.1.p 244 ELKGQLLRKYRGYLGSLKQEF 264
                          9*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.6E-20107151IPR005540KNOX1
PfamPF037904.9E-22108147IPR005540KNOX1
SMARTSM012561.3E-25156207IPR005541KNOX2
PfamPF037911.0E-21159206IPR005541KNOX2
PfamPF037895.6E-9244264IPR005539ELK domain
SMARTSM011885.9E-7244265IPR005539ELK domain
PROSITE profilePS5121311.139244264IPR005539ELK domain
PROSITE profilePS5007113.167264327IPR001356Homeobox domain
SuperFamilySSF466891.88E-19266342IPR009057Homeodomain-like
SMARTSM003891.2E-12266331IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.7E-28269329IPR009057Homeodomain-like
CDDcd000861.14E-12276328No hitNo description
PfamPF059206.5E-17284323IPR008422Homeobox KN domain
PROSITE patternPS000270302325IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGEEAMEGVI SSKGMGFGEN TSSSGVCPMM MMPLVTSHHV GHHPLNHPIL NNPNPNEHTN  60
TLFLPMPCTN NNHHPNRNNH NSNATELGYF MEIPNNNNDG SSSSPSSAVK AKIMAHPHYH  120
RLLAAYVNCQ KVGAPPEVVG RLEEACASAA VIMAGGTASI GEDPALDQFM EAYCEMLIKY  180
EQELSKPFKE AMLFLQRIEC QFKSLTISSS LDTTACNEAI DRNGPSEDVD VQTNIIDPQA  240
EDQELKGQLL RKYRGYLGSL KQEFTKKRKK GKLPKEARQQ LLEWWSRHYK WPYPSESQKL  300
ALAESTGLDQ KQINNWFINQ RKRHWKPSED MQFVVVDPSH PHYYMENVLG NPFPMDLSHP  360
ML*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1259268LKQEFTKKRK
2265269KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.256080.0flower| root| stem
Function -- GeneRIF ? help Back to Top
  1. results indicated that the GmKNT1 could affect multiple aspects of plant growth and development by regulation of downstream genes expression
    [PMID: 18640623]
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8573390.0DQ857339.1 Glycine max KNT1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237352.10.0KNT1
SwissprotP466081e-166HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA7J0W00.0A7J0W0_SOYBN; KNT1
STRINGGLYMA07G39350.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-131KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Liu J, et al.
    Ectopic expression of soybean GmKNT1 in Arabidopsis results in altered leaf morphology and flower identity.
    J Genet Genomics, 2008. 35(7): p. 441-9
    [PMID:18640623]